PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00078.58
Common NameAMTR_s00078p00085160, LOC18431928
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 306aa    MW: 34654.6 Da    PI: 4.4942
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00078.58genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.9e-1970123356
                                              --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                 Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                              k+++++++q++ Le+ Fe ++++  e++ +LA++lgL+ rqV +WFqNrRa++k
  evm_27.model.AmTr_v1.0_scaffold00078.58  70 KKRRLSPDQVQFLEKNFEVENKLEPERKIQLARELGLQPRQVAIWFQNRRARWK 123
                                              56689************************************************9 PP

2HD-ZIP_I/II131.53.2e-4269159191
                              HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkray 70 
                                              ekkrrls +qv++LE++Fe e+kLeperK +lareLglqprqva+WFqnrRAR+ktkqlEkdy +Lk++y
  evm_27.model.AmTr_v1.0_scaffold00078.58  69 EKKRRLSPDQVQFLEKNFEVENKLEPERKIQLARELGLQPRQVAIWFQNRRARWKTKQLEKDYGVLKSSY 138
                                              69******************************************************************** PP

                              HD-ZIP_I/II  71 dalkeenerLekeveeLreel 91 
                                              dalk++ e+L ke+e+L++e+
  evm_27.model.AmTr_v1.0_scaffold00078.58 139 DALKADYENLLKEKEKLKTEV 159
                                              ******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-2059127IPR009057Homeodomain-like
PROSITE profilePS5007117.65365125IPR001356Homeobox domain
SMARTSM003892.7E-1968129IPR001356Homeobox domain
PfamPF000467.4E-1770123IPR001356Homeobox domain
CDDcd000862.35E-1870126No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2071132IPR009057Homeodomain-like
PRINTSPR000317.5E-696105IPR000047Helix-turn-helix motif
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PRINTSPR000317.5E-6105121IPR000047Helix-turn-helix motif
PfamPF021832.6E-17125166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MAGGRVYGGS NLNVVLQGEG LPCSSDALDA LLVSCSSPSF HGARSMVNFE EINANSTEED  60
FDECFHQPEK KRRLSPDQVQ FLEKNFEVEN KLEPERKIQL ARELGLQPRQ VAIWFQNRRA  120
RWKTKQLEKD YGVLKSSYDA LKADYENLLK EKEKLKTEVV LLTDKLLSKE RDCQVPATNW  180
PEKLELKCQT TPKTETVKDS DLLLNCKQED LSSNSSVFDA ESPTEAGNSP EFFAGNSPEI  240
FEPDNYSDSS LGEEESGKVC KERFKSPQAF VLPKLEEPTY PDQASGTCNY GFHVDDQEPL  300
WFWPY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006842102.10.0PREDICTED: homeobox-leucine zipper protein HAT5
TrEMBLW1P1R90.0W1P1R9_AMBTC; Uncharacterized protein
STRINGVIT_17s0000g05630.t018e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-40homeobox 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]